Lineage for d1fbr_1 (1fbr 1-46)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41114Fold g.27: Fibronectin type I module [57602] (1 superfamily)
  4. 41115Superfamily g.27.1: Fibronectin type I module [57603] (1 family) (S)
  5. 41116Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
  6. 41117Protein Fibronectin [57605] (1 species)
  7. 41118Species Human (Homo sapiens) [TaxId:9606] [57606] (5 PDB entries)
  8. 41119Domain d1fbr_1: 1fbr 1-46 [44948]

Details for d1fbr_1

PDB Entry: 1fbr (more details)

PDB Description: fourth and fifth fibronectin type i module pair

SCOP Domain Sequences for d1fbr_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbr_1 g.27.1.1 (1-46) Fibronectin {Human (Homo sapiens)}
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsr

SCOP Domain Coordinates for d1fbr_1:

Click to download the PDB-style file with coordinates for d1fbr_1.
(The format of our PDB-style files is described here.)

Timeline for d1fbr_1:

41119
d1fbr_1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1fbr_2