SCOPe 2.08: Domain d1fbra1: 1fbr A:1-46

Lineage for d1fbra1 (1fbr A:1-46)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (3 families)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
   automatically mapped to Pfam PF00039

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (12 PDB entries)

8. Domain d1fbra1: 1fbr A:1-46 [44948]
   4th & 5th modules

Details for d1fbra1

PDB Entry: 1fbr

PDB Description: fourth and fifth fibronectin type i module pair

PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d1fbra1:

Sequence; same for both SEQRES and ATOM records:

>d1fbra1 g.27.1.1 (A:1-46) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
aekcfdhaagtsyvvgetwekpyqgwmmvdctclgegsgritctsr

Timeline for d1fbra1:

• d1fbra1 first appeared (with stable ids) in SCOP 1.55, called d1fbr_1
  
• d1fbra1 appears in SCOPe 2.07