Lineage for d1klaa_ (1kla A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40812Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 40813Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) (S)
  5. 40846Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (6 proteins)
  6. 40861Protein TGF-beta1 [57512] (1 species)
  7. 40862Species Human (Homo sapiens) [TaxId:9606] [57513] (3 PDB entries)
  8. 40863Domain d1klaa_: 1kla A: [44779]

Details for d1klaa_

PDB Entry: 1kla (more details)

PDB Description: solution structure of tgf-b1, nmr, models 1-17 of 33 structures

SCOP Domain Sequences for d1klaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1klaa_ g.17.1.2 (A:) TGF-beta1 {Human (Homo sapiens)}
aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs

SCOP Domain Coordinates for d1klaa_:

Click to download the PDB-style file with coordinates for d1klaa_.
(The format of our PDB-style files is described here.)

Timeline for d1klaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1klab_