PDB entry 1kla

View 1kla on RCSB PDB site
Description: solution structure of tgf-b1, nmr, models 1-17 of 33 structures
Deposited on 1996-01-16, released 1996-08-17
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-17, with a file datestamp of 1996-09-19.
Experiment type: NMR17
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1klaa_
  • Chain 'B':
    Domains in SCOP 1.55: d1klab_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klaA (A:)
    aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
    vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1klaB (B:)
    aldtnycfssteknccvrqlyidfrkdlgwkwihepkgyhanfclgpcpyiwsldtqysk
    vlalynqhnpgasaapccvpqaleplpivyyvgrkpkveqlsnmivrsckcs