Class g: Small proteins [56992] (98 folds) |
Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies) disulfide-rich fold; common core is alpha+beta with two conserved disulfides |
Superfamily g.16.1: Trefoil [57492] (1 family) |
Family g.16.1.1: Trefoil [57493] (4 proteins) |
Protein Pancreatic spasmolytic polypeptide [57494] (1 species) duplication: consists of two homologous domains |
Species Pig (Sus scrofa) [TaxId:9823] [57495] (4 PDB entries) |
Domain d2pspa1: 2psp A:1-53 [44730] |
PDB Entry: 2psp (more details), 1.95 Å
SCOPe Domain Sequences for d2pspa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pspa1 g.16.1.1 (A:1-53) Pancreatic spasmolytic polypeptide {Pig (Sus scrofa) [TaxId: 9823]} ekpaacrcsrqdpknrvncgfpgitsdqcftsgccfdsqvpgvpwcfkplpaq
Timeline for d2pspa1: