Lineage for d2pspa1 (2psp A:1-53)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033514Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 3033515Superfamily g.16.1: Trefoil [57492] (1 family) (S)
  5. 3033516Family g.16.1.1: Trefoil [57493] (4 proteins)
  6. 3033522Protein Pancreatic spasmolytic polypeptide [57494] (1 species)
    duplication: consists of two homologous domains
  7. 3033523Species Pig (Sus scrofa) [TaxId:9823] [57495] (4 PDB entries)
  8. 3033524Domain d2pspa1: 2psp A:1-53 [44730]

Details for d2pspa1

PDB Entry: 2psp (more details), 1.95 Å

PDB Description: porcine pancreatic spasmolytic polypeptide
PDB Compounds: (A:) porcine pancreatic spasmolytic polypeptide

SCOPe Domain Sequences for d2pspa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pspa1 g.16.1.1 (A:1-53) Pancreatic spasmolytic polypeptide {Pig (Sus scrofa) [TaxId: 9823]}
ekpaacrcsrqdpknrvncgfpgitsdqcftsgccfdsqvpgvpwcfkplpaq

SCOPe Domain Coordinates for d2pspa1:

Click to download the PDB-style file with coordinates for d2pspa1.
(The format of our PDB-style files is described here.)

Timeline for d2pspa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pspa2