Lineage for d2pspa1 (2psp A:1-53)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40785Fold g.16: Trefoil [57491] (1 superfamily)
  4. 40786Superfamily g.16.1: Trefoil [57492] (1 family) (S)
  5. 40787Family g.16.1.1: Trefoil [57493] (3 proteins)
  6. 40791Protein Pancreatic spasmolytic polypeptide [57494] (1 species)
  7. 40792Species Pig (Sus scrofa) [TaxId:9823] [57495] (4 PDB entries)
  8. 40793Domain d2pspa1: 2psp A:1-53 [44730]

Details for d2pspa1

PDB Entry: 2psp (more details), 1.95 Å

PDB Description: porcine pancreatic spasmolytic polypeptide

SCOP Domain Sequences for d2pspa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pspa1 g.16.1.1 (A:1-53) Pancreatic spasmolytic polypeptide {Pig (Sus scrofa)}
ekpaacrcsrqdpknrvncgfpgitsdqcftsgccfdsqvpgvpwcfkplpaq

SCOP Domain Coordinates for d2pspa1:

Click to download the PDB-style file with coordinates for d2pspa1.
(The format of our PDB-style files is described here.)

Timeline for d2pspa1:

40793
d2pspa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2pspa2