![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies) disulfide-rich fold; common core is alpha+beta with two conserved disulfides |
![]() | Superfamily g.16.1: Trefoil [57492] (1 family) ![]() |
![]() | Family g.16.1.1: Trefoil [57493] (4 proteins) |
![]() | Protein Pancreatic spasmolytic polypeptide [57494] (1 species) duplication: consists of two homologous domains |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [57495] (4 PDB entries) |
![]() | Domain d2pspa2: 2psp A:54-106 [44731] |
PDB Entry: 2psp (more details), 1.95 Å
SCOPe Domain Sequences for d2pspa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pspa2 g.16.1.1 (A:54-106) Pancreatic spasmolytic polypeptide {Pig (Sus scrofa) [TaxId: 9823]} eseecvmqvsarkncgypgispedcaarnccfsdtipevpwcffpmsvedchy
Timeline for d2pspa2: