SCOP 1.59: Domain d1e0fj_: 1e0f J:

Lineage for d1e0fj_ (1e0f J:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)

4. Superfamily g.3.15: Leech antihemostatic proteins [57262] (2 families)

5. Family g.3.15.2: Hirudin-like [57270] (3 proteins)

6. Protein Haemadin [57275] (1 species)

7. Species Indian leech (Haemadipsa sylvestris) [TaxId:13555] [57276] (1 PDB entry)

8. Domain d1e0fj_: 1e0f J: [44378]
   Other proteins in same PDB: d1e0f.1, d1e0f.2, d1e0f.3

Details for d1e0fj_

PDB Entry: 1e0f, 3.1 Å

PDB Description: crystal structure of the human alpha-thrombin-haemadin complex: an exosite ii-binding inhibitor

SCOP Domain Sequences for d1e0fj_:

Sequence; same for both SEQRES and ATOM records:

>d1e0fj_ g.3.15.2 (J:) Haemadin {Indian leech (Haemadipsa sylvestris)}
irfgmgkvpcpdgevgytcdcgekiclygqscndgqcsgdpkpssefeefeidee

Timeline for d1e0fj_:

• d1e0fj_ first appeared (with stable ids) in SCOP 1.55
  
• d1e0fj_ appears in SCOP 1.57
  
• d1e0fj_ appears in SCOP 1.61
  
• d1e0fj_ appears in the current release, SCOPe 2.08