Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.15: Leech antihemostatic proteins [57262] (3 families) |
Family g.3.15.2: Hirudin-like [57270] (4 proteins) |
Protein Haemadin [57275] (1 species) |
Species Indian leech (Haemadipsa sylvestris) [TaxId:13555] [57276] (1 PDB entry) |
Domain d1e0fj_: 1e0f J: [44378] Other proteins in same PDB: d1e0f.1, d1e0f.2, d1e0f.3 |
PDB Entry: 1e0f (more details), 3.1 Å
SCOPe Domain Sequences for d1e0fj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0fj_ g.3.15.2 (J:) Haemadin {Indian leech (Haemadipsa sylvestris) [TaxId: 13555]} irfgmgkvpcpdgevgytcdcgekiclygqscndgqcsgdpkpssefeefeidee
Timeline for d1e0fj_: