Lineage for d1e0fk_ (1e0f K:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3032001Superfamily g.3.15: Leech antihemostatic proteins [57262] (3 families) (S)
  5. 3032023Family g.3.15.2: Hirudin-like [57270] (4 proteins)
  6. 3032027Protein Haemadin [57275] (1 species)
  7. 3032028Species Indian leech (Haemadipsa sylvestris) [TaxId:13555] [57276] (1 PDB entry)
  8. 3032031Domain d1e0fk_: 1e0f K: [44379]
    Other proteins in same PDB: d1e0f.1, d1e0f.2, d1e0f.3

Details for d1e0fk_

PDB Entry: 1e0f (more details), 3.1 Å

PDB Description: crystal structure of the human alpha-thrombin-haemadin complex: an exosite ii-binding inhibitor
PDB Compounds: (K:) haemadin

SCOPe Domain Sequences for d1e0fk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0fk_ g.3.15.2 (K:) Haemadin {Indian leech (Haemadipsa sylvestris) [TaxId: 13555]}
irfgmgkvpcpdgevgytcdcgekiclygqscndgqcsgdpkpssefeefeideeek

SCOPe Domain Coordinates for d1e0fk_:

Click to download the PDB-style file with coordinates for d1e0fk_.
(The format of our PDB-style files is described here.)

Timeline for d1e0fk_: