SCOPe 2.08: Domain d1e0f.3: 1e0f C:,F:

Lineage for d1e0f.3 (1e0f C:,F:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (171 PDB entries)
   Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620

8. Domain d1e0f.3: 1e0f C:,F: [26186]
   Other proteins in same PDB: d1e0fi_, d1e0fj_, d1e0fk_

Details for d1e0f.3

PDB Entry: 1e0f, 3.1 Å

PDB Description: crystal structure of the human alpha-thrombin-haemadin complex: an exosite ii-binding inhibitor

PDB Compounds: (C:) thrombin, (F:) thrombin

SCOPe Domain Sequences for d1e0f.3:

Sequence; same for both SEQRES and ATOM records:

>g1e0f.3 b.47.1.2 (C:,F:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
fgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrkspq
ellcgaslisdrwvltaahcllyppwdknfiendllvrigkhsrtryerniekismleki
yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl
ketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegd
sggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

Timeline for d1e0f.3:

• d1e0f.3 first appeared (with stable ids) in SCOP 1.55
  
• d1e0f.3 appears in SCOPe 2.07