SCOP 1.59: Domain d1e0f.3: 1e0f C:,F:

Lineage for d1e0f.3 (1e0f C:,F:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (126 PDB entries)

8. Domain d1e0f.3: 1e0f C:,F: [26186]
   Other proteins in same PDB: d1e0fi_, d1e0fj_, d1e0fk_

Details for d1e0f.3

PDB Entry: 1e0f, 3.1 Å

PDB Description: crystal structure of the human alpha-thrombin-haemadin complex: an exosite ii-binding inhibitor

SCOP Domain Sequences for d1e0f.3:

Sequence; same for both SEQRES and ATOM records:

>g1e0f.3 b.47.1.2 (C:,F:) Thrombin {Human (Homo sapiens)}
fgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrkspq
ellcgaslisdrwvltaahcllyppwdknfiendllvrigkhsrtryerniekismleki
yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl
ketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegd
sggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

Timeline for d1e0f.3:

• d1e0f.3 first appeared (with stable ids) in SCOP 1.55
  
• d1e0f.3 appears in SCOP 1.57
  
• d1e0f.3 appears in SCOP 1.61
  
• d1e0f.3 appears in the current release, SCOPe 2.08