Lineage for d1e0fj_ (1e0f J:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 202518Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
  4. 203268Superfamily g.3.15: Leech antihemostatic proteins [57262] (2 families) (S)
  5. 203290Family g.3.15.2: Hirudin-like [57270] (3 proteins)
  6. 203294Protein Haemadin [57275] (1 species)
  7. 203295Species Indian leech (Haemadipsa sylvestris) [TaxId:13555] [57276] (1 PDB entry)
  8. 203297Domain d1e0fj_: 1e0f J: [44378]
    Other proteins in same PDB: d1e0f.1, d1e0f.2, d1e0f.3

Details for d1e0fj_

PDB Entry: 1e0f (more details), 3.1 Å

PDB Description: crystal structure of the human alpha-thrombin-haemadin complex: an exosite ii-binding inhibitor

SCOP Domain Sequences for d1e0fj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0fj_ g.3.15.2 (J:) Haemadin {Indian leech (Haemadipsa sylvestris)}
irfgmgkvpcpdgevgytcdcgekiclygqscndgqcsgdpkpssefeefeidee

SCOP Domain Coordinates for d1e0fj_:

Click to download the PDB-style file with coordinates for d1e0fj_.
(The format of our PDB-style files is described here.)

Timeline for d1e0fj_: