SCOP 1.55: Domain d1hic__: 1hic -

Lineage for d1hic__ (1hic -)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)

4. Superfamily g.3.15: Leech antihemostatic proteins [57262] (2 families)

5. Family g.3.15.2: Hirudin-like [57270] (3 proteins)

6. Protein Hirudin [57271] (1 species)

7. Species Leech (Hirudo medicinalis) [TaxId:6421] [57272] (8 PDB entries)

8. Domain d1hic__: 1hic - [44371]

Details for d1hic__

PDB Entry: 1hic

PDB Description: the nmr solution structure of hirudin(1-51) and comparison with corresponding three-dimensional structures determined using the complete 65-residue hirudin polypeptide chain

SCOP Domain Sequences for d1hic__:

Sequence; same for both SEQRES and ATOM records:

>d1hic__ g.3.15.2 (-) Hirudin {Leech (Hirudo medicinalis)}
vvytdctesgqnlclcegsnvcgqgnkcilgsdgeknqcvtgegtpkpqsh

Timeline for d1hic__:

• d1hic__ appears in SCOP 1.57
  
• d1hic__ appears in the current release, SCOPe 2.08, called d1hica_