Lineage for d1hic__ (1hic -)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) 
Superfamily g.3.15: Leech antihemostatic proteins [57262] (2 families) 
Family g.3.15.2: Hirudin-like [57270] (3 proteins) Protein Hirudin [57271] (1 species) Species Leech (Hirudo medicinalis) [TaxId:6421] [57272] (8 PDB entries) 
Domain d1hic__: 1hic - [44371]
Details for d1hic__
PDB Entry: 1hic (more details)
PDB Description: the nmr solution structure of hirudin(1-51) and comparison with corresponding three-dimensional structures determined using the complete 65-residue hirudin polypeptide chain
SCOP Domain Sequences for d1hic__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hic__ g.3.15.2 (-) Hirudin {Leech (Hirudo medicinalis)}
vvytdctesgqnlclcegsnvcgqgnkcilgsdgeknqcvtgegtpkpqsh
SCOP Domain Coordinates for d1hic__:
Click to download the PDB-style file with coordinates for d1hic__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hic__:
- d1hic__ first appeared (with stable ids) in SCOP 1.55
- d1hic__ appears in SCOP 1.59
- d1hic__ appears in the current release, SCOPe 2.08, called d1hica_
View in 3D