Lineage for d1dqba1 (1dqb A:1-44)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
Superfamily g.3.11: EGF/Laminin [57196] (8 families) 
Family g.3.11.1: EGF-type module [57197] (23 proteins) 
Protein Thrombomodulin, different EGF-like domains [57225] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57226] (6 PDB entries) 
Domain d1dqba1: 1dqb A:1-44 [44318]
complexed with nag
Details for d1dqba1
PDB Entry: 1dqb (more details)
PDB Description: nmr structure of thrombomodulin egf(4-5)
PDB Compounds: (A:) thrombomodulinSCOPe Domain Sequences for d1dqba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqba1 g.3.11.1 (A:1-44) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
hmepvdpcfranceyqcqplnqtsylcvcaegfapiphephrcq
SCOPe Domain Coordinates for d1dqba1:
Click to download the PDB-style file with coordinates for d1dqba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dqba1:
- d1dqba1 first appeared (with stable ids) in SCOP 1.55
- d1dqba1 appears in SCOPe 2.07
View in 3D
