![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Thrombomodulin, different EGF-like domains [57225] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57226] (6 PDB entries) |
![]() | Domain d1dqba1: 1dqb A:1-44 [44318] complexed with nag |
PDB Entry: 1dqb (more details)
SCOPe Domain Sequences for d1dqba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqba1 g.3.11.1 (A:1-44) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} hmepvdpcfranceyqcqplnqtsylcvcaegfapiphephrcq
Timeline for d1dqba1: