Lineage for d1autl1 (1aut L:49-96)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2582604Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2582605Protein Activated protein c (autoprothrombin IIa) [57208] (1 species)
  7. 2582606Species Human (Homo sapiens) [TaxId:9606] [57209] (1 PDB entry)
  8. 2582607Domain d1autl1: 1aut L:49-96 [44244]
    Other proteins in same PDB: d1autc_
    complexed with 0g6

Details for d1autl1

PDB Entry: 1aut (more details), 2.8 Å

PDB Description: Human activated protein C
PDB Compounds: (L:) activated protein c

SCOPe Domain Sequences for d1autl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}
qclvlplehpcaslccghgtcidgigsfscdcrsgwegrfcqrevsfl

SCOPe Domain Coordinates for d1autl1:

Click to download the PDB-style file with coordinates for d1autl1.
(The format of our PDB-style files is described here.)

Timeline for d1autl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1autl2
View in 3D
Domains from other chains:
(mouse over for more information)
d1autc_