SCOPe 2.08: Domain d1autl1: 1aut L:49-96

Lineage for d1autl1 (1aut L:49-96)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Activated protein c (autoprothrombin IIa) [57208] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57209] (1 PDB entry)

8. Domain d1autl1: 1aut L:49-96 [44244]
   Other proteins in same PDB: d1autc_
   complexed with 0g6

Details for d1autl1

PDB Entry: 1aut, 2.8 Å

PDB Description: Human activated protein C

PDB Compounds: (L:) activated protein c

SCOPe Domain Sequences for d1autl1:

Sequence; same for both SEQRES and ATOM records:

>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}
qclvlplehpcaslccghgtcidgigsfscdcrsgwegrfcqrevsfl

Timeline for d1autl1:

• d1autl1 first appeared (with stable ids) in SCOP 1.55
  
• d1autl1 appears in SCOPe 2.07