PDB entry 1aut

View 1aut on RCSB PDB site
Description: Human activated protein C
Class: hydrolase/hydrolase inhibitor
Keywords: SERINE PROTEINASE, PLASMA CALCIUM BINDING, GLYCOPROTEIN, HYDROLASE-HYDROLASE INHIBITOR complex, BLOOD CLOTTING
Deposited on 1996-06-08, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: activated protein c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1autc_
  • Chain 'L':
    Compound: activated protein c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1autl1, d1autl2
  • Heterogens: 0G6, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1autC (C:)
    lidgkmtrrgdspwqvvlldskkklacgavlihpswvltaahcmdeskkllvrlgeydlr
    rwekweldldikevfvhpnysksttdndiallhlaqpatlsqtivpiclpdsglaereln
    qagqetlvtgwgyhssrekeakrnrtfvlnfikipvvphnecsevmsnmvsenmlcagil
    gdrqdacegdsggpmvasfhgtwflvglvswgegcgllhnygvytkvsryldwihghird
    keapqkswap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1autC (C:)
    lidgkmtrrgdspwqvvlldskkklacgavlihpswvltaahcmdeskkllvrlgeydlr
    rwekweldldikevfvhpnysksttdndiallhlaqpatlsqtivpiclpdsglaereln
    qagqetlvtgwgyhssrekeakrnrtfvlnfikipvvphnecsevmsnmvsenmlcagil
    gdrqdacegdsggpmvasfhgtwflvglvswgegcgllhnygvytkvsryldwihghird
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1autL (L:)
    skhvdgdqclvlplehpcaslccghgtcidgigsfscdcrsgwegrfcqrevsflncsld
    nggcthycleevgwrrcscapgyklgddllqchpavkfpcgrpwkrmekkrshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1autL (L:)
    qclvlplehpcaslccghgtcidgigsfscdcrsgwegrfcqrevsflncsldnggcthy
    cleevgwrrcscapgyklgddllqchpavkfpcgrpwk