Class g: Small proteins [56992] (100 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (5 proteins) |
Protein Insulin [56996] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56998] (63 PDB entries) Uniprot P01308 |
Domain d1aiy.5: 1aiy J:,I: [43934] complexed with iph, zn |
PDB Entry: 1aiy (more details)
SCOPe Domain Sequences for d1aiy.5:
Sequence; same for both SEQRES and ATOM records: (download)
>g1aiy.5 g.1.1.1 (J:,I:) Insulin {Human (Homo sapiens) [TaxId: 9606]} fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn
Timeline for d1aiy.5: