Lineage for d1aiy.5 (1aiy J:,I:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39386Fold g.1: Insulin-like [56993] (1 superfamily)
  4. 39387Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 39388Family g.1.1.1: Insulin-like [56995] (4 proteins)
  6. 39393Protein Insulin [56996] (3 species)
  7. 39403Species Human (Homo sapiens) [TaxId:9606] [56998] (42 PDB entries)
  8. 39495Domain d1aiy.5: 1aiy J:,I: [43934]

Details for d1aiy.5

PDB Entry: 1aiy (more details)

PDB Description: r6 human insulin hexamer (symmetric), nmr, 10 structures

SCOP Domain Sequences for d1aiy.5:

Sequence; same for both SEQRES and ATOM records: (download)

>g1aiy.5 g.1.1.1 (J:,I:) Insulin {Human (Homo sapiens)}
fvnqhlcgshlvealylvcgergffytpktXgiveqcctsicslyqlenycn

SCOP Domain Coordinates for d1aiy.5:

Click to download the PDB-style file with coordinates for d1aiy.5.
(The format of our PDB-style files is described here.)

Timeline for d1aiy.5: