SCOP 1.55: Domain d1ek2b1: 1ek2 B:4-225

Lineage for d1ek2b1 (1ek2 B:4-225)

1. Root: SCOP 1.55

2. Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)

3. Fold e.21: HAD-like [56783] (1 superfamily)

4. Superfamily e.21.1: HAD-like [56784] (3 families)

5. Family e.21.1.2: Epoxide hydrolase, N-terminal domain [56789] (1 protein)

6. Protein Epoxide hydrolase, N-terminal domain [56790] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [56791] (4 PDB entries)

8. Domain d1ek2b1: 1ek2 B:4-225 [43342]
   Other proteins in same PDB: d1ek2a2, d1ek2b2

Details for d1ek2b1

PDB Entry: 1ek2, 3 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase complexed with cdu inhibitor

SCOP Domain Sequences for d1ek2b1:

Sequence; same for both SEQRES and ATOM records:

>d1ek2b1 e.21.1.2 (B:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus)}
rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeap

Timeline for d1ek2b1:

• d1ek2b1 appears in SCOP 1.57
  
• d1ek2b1 appears in the current release, SCOPe 2.08