Lineage for d1ek2b1 (1ek2 B:4-225)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 87342Fold e.21: HAD-like [56783] (1 superfamily)
  4. 87343Superfamily e.21.1: HAD-like [56784] (4 families) (S)
  5. 87360Family e.21.1.2: Epoxide hydrolase, N-terminal domain [56789] (1 protein)
  6. 87361Protein Epoxide hydrolase, N-terminal domain [56790] (1 species)
  7. 87362Species Mouse (Mus musculus) [TaxId:10090] [56791] (4 PDB entries)
  8. 87370Domain d1ek2b1: 1ek2 B:4-225 [43342]
    Other proteins in same PDB: d1ek2a2, d1ek2b2

Details for d1ek2b1

PDB Entry: 1ek2 (more details), 3 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase complexed with cdu inhibitor

SCOP Domain Sequences for d1ek2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek2b1 e.21.1.2 (B:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus)}
rvaafdldgvlalpsiagafrrseealalprdfllgayqtefpegpteqlmkgkitfsqw
vplmdesyrksskacganlpenfsisqifsqamaarsinrpmlqaaialkkkgfttcivt
nnwlddgdkrdslaqmmcelsqhfdfliescqvgmikpepqiynflldtlkakpnevvfl
ddfgsnlkpardmgmvtilvhntasalrelekvtgtqfpeap

SCOP Domain Coordinates for d1ek2b1:

Click to download the PDB-style file with coordinates for d1ek2b1.
(The format of our PDB-style files is described here.)

Timeline for d1ek2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ek2b2