Lineage for d1qssa2 (1qss A:423-831)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38209Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 38210Superfamily e.8.1: DNA/RNA polymerases [56672] (4 families) (S)
  5. 38211Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 38212Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 38233Species Thermus aquaticus [TaxId:271] [56676] (13 PDB entries)
  8. 38238Domain d1qssa2: 1qss A:423-831 [42990]
    Other proteins in same PDB: d1qssa1

Details for d1qssa2

PDB Entry: 1qss (more details), 2.3 Å

PDB Description: ddgtp-trapped closed ternary complex of the large fragment of dna polymerase i from thermus aquaticus

SCOP Domain Sequences for d1qssa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qssa2 e.8.1.1 (A:423-831) DNA polymerase I (Klenow fragment) {Thermus aquaticus}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsak

SCOP Domain Coordinates for d1qssa2:

Click to download the PDB-style file with coordinates for d1qssa2.
(The format of our PDB-style files is described here.)

Timeline for d1qssa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qssa1