PDB entry 1qss

View 1qss on RCSB PDB site
Description: ddgtp-trapped closed ternary complex of the large fragment of dna polymerase i from thermus aquaticus
Deposited on 1999-06-23, released 1999-08-16
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-03, with a file datestamp of 2000-05-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qssA (A:)
    aleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeergll
    akdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraalserl
    fanlwgrlegeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarlea
    evfrlaghpfnlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpiveki
    lqyreltklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgq
    rirrafiaeegwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpre
    avdplmrraaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektle
    egrrrgyvetlfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprl
    eemgarmllqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsak