Lineage for d1pmd_4 (1pmd 264-630)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins) 
Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species) Species Streptococcus pneumoniae [TaxId:1313] [56625] (3 PDB entries) 
Domain d1pmd_4: 1pmd 264-630 [42771]
Other proteins in same PDB: d1pmd_1, d1pmd_2, d1pmd_3
Details for d1pmd_4
PDB Entry: 1pmd (more details), 3.5 Å
PDB Description: penicillin-binding protein 2x (pbp-2x)
SCOP Domain Sequences for d1pmd_4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmd_4 e.3.1.1 (264-630) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Streptococcus pneumoniae}
tissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtkegitedfv
wrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatirdwdvnegltgg
rmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyagqlpadniv
niaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksqkeivgnpv
skdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiadeknggylv
gltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkdslnlqtt
akaleqv
SCOP Domain Coordinates for d1pmd_4:
Click to download the PDB-style file with coordinates for d1pmd_4.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pmd_4:
- d1pmd_4 appears in SCOP 1.57
- d1pmd_4 appears in the current release, SCOPe 2.08, called d1pmda4
View in 3D
