Lineage for d1pmd_3 (1pmd 76-263)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.175: Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56518] (1 superfamily) Superfamily d.175.1: Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56519] (1 family) 
Family d.175.1.1: Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56520] (1 protein) Protein Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56521] (1 species) Species Streptococcus pneumoniae [TaxId:1313] [56522] (3 PDB entries) 
Domain d1pmd_3: 1pmd 76-263 [42562]
Other proteins in same PDB: d1pmd_1, d1pmd_2, d1pmd_4
Details for d1pmd_3
PDB Entry: 1pmd (more details), 3.5 Å
PDB Description: penicillin-binding protein 2x (pbp-2x)
SCOP Domain Sequences for d1pmd_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmd_3 d.175.1.1 (76-263) Penicillin-binding protein 2x (pbp-2x), N-terminal domain {Streptococcus pneumoniae}
rgtiydrngvpiaedatsynvyavidenyksatgkilyvektqfnkvaevfhkyldmees
yvreqlsqpnlkqvsfgakgngityanmmsikkeleaaevkgidfttspnrsypngqfas
sfiglaqlhenedgsksllgtsgmesslnsilagtdgiityekdrlgnivpgteqvsqrt
mdgkdvyt
SCOP Domain Coordinates for d1pmd_3:
Click to download the PDB-style file with coordinates for d1pmd_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pmd_3:
- d1pmd_3 appears in SCOP 1.57
- d1pmd_3 appears in the current release, SCOPe 2.08, called d1pmda3
View in 3D
