Lineage for d1bza__ (1bza -)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 37843Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 37844Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 37845Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins)
  6. 37871Protein beta-Lactamase, class A [56606] (11 species)
  7. 37894Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (1 PDB entry)
  8. 37895Domain d1bza__: 1bza - [42701]

Details for d1bza__

PDB Entry: 1bza (more details), 1.8 Å

PDB Description: beta-lactamase toho-1 from escherichia coli tuh12191

SCOP Domain Sequences for d1bza__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bza__ e.3.1.1 (-) beta-Lactamase, class A {Escherichia coli, TOHO-1}
svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
tafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
kaerrrdilaaaakivt

SCOP Domain Coordinates for d1bza__:

Click to download the PDB-style file with coordinates for d1bza__.
(The format of our PDB-style files is described here.)

Timeline for d1bza__: