PDB entry 1bza

View 1bza on RCSB PDB site
Description: beta-lactamase toho-1 from escherichia coli tuh12191
Deposited on 1998-10-28, released 1999-04-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1bza__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bza_ (-)
    svqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdk
    hllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkv
    tafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlv
    twlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeq
    kaerrrdilaaaakivt