Lineage for d7api.1 (7api A:,B:)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883177Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 883178Superfamily e.1.1: Serpins [56574] (1 family) (S)
  5. 883179Family e.1.1.1: Serpins [56575] (16 proteins)
  6. 883243Protein Antitrypsin, alpha-1 [56582] (1 species)
  7. 883244Species Human (Homo sapiens) [TaxId:9606] [56583] (15 PDB entries)
  8. 883255Domain d7api.1: 7api A:,B: [42631]
    complexed with man, nag

Details for d7api.1

PDB Entry: 7api (more details), 3 Å

PDB Description: the s variant of human alpha1-antitrypsin, structure and implications for function and metabolism
PDB Compounds: (A:) alpha 1-antitrypsin, (B:) alpha 1-antitrypsin

SCOP Domain Sequences for d7api.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g7api.1 e.1.1.1 (A:,B:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
hptfnkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileg
lnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyh
seaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfe
vkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegk
lqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadls
gvteeaplklskavhkavltidekgteaagamfleaipmXsippevkfnkpfvflmieqn
tksplfmgkvvnptqk

SCOP Domain Coordinates for d7api.1:

Click to download the PDB-style file with coordinates for d7api.1.
(The format of our PDB-style files is described here.)

Timeline for d7api.1: