Lineage for d7api.1 (7api A:,B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012400Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 3012401Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 3012402Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 3012470Protein Antitrypsin, alpha-1 [56582] (1 species)
  7. 3012471Species Human (Homo sapiens) [TaxId:9606] [56583] (15 PDB entries)
  8. 3012481Domain d7api.1: 7api A:,B: [42631]
    complexed with cys

Details for d7api.1

PDB Entry: 7api (more details), 3 Å

PDB Description: the s variant of human alpha1-antitrypsin, structure and implications for function and metabolism
PDB Compounds: (A:) alpha 1-antitrypsin, (B:) alpha 1-antitrypsin

SCOPe Domain Sequences for d7api.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g7api.1 e.1.1.1 (A:,B:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
hptfnkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileg
lnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyh
seaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfe
vkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegk
lqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadls
gvteeaplklskavhkavltidekgteaagamfleaipmXsippevkfnkpfvflmieqn
tksplfmgkvvnptqk

SCOPe Domain Coordinates for d7api.1:

Click to download the PDB-style file with coordinates for d7api.1.
(The format of our PDB-style files is described here.)

Timeline for d7api.1: