Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.1: Serpins [56573] (1 superfamily) contains a cluster of helices and a beta-sandwich |
Superfamily e.1.1: Serpins [56574] (2 families) |
Family e.1.1.1: Serpins [56575] (17 proteins) automatically mapped to Pfam PF00079 |
Protein Antitrypsin, alpha-1 [56582] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56583] (15 PDB entries) |
Domain d7api.1: 7api A:,B: [42631] complexed with cys |
PDB Entry: 7api (more details), 3 Å
SCOPe Domain Sequences for d7api.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g7api.1 e.1.1.1 (A:,B:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} hptfnkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileg lnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyh seaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfe vkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegk lqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadls gvteeaplklskavhkavltidekgteaagamfleaipmXsippevkfnkpfvflmieqn tksplfmgkvvnptqk
Timeline for d7api.1: