SCOPe 2.01: Domain d7api.1: 7api A:,B:

Lineage for d7api.1 (7api A:,B:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.1: Serpins [56573] (1 superfamily)
   contains a cluster of helices and a beta-sandwich

4. Superfamily e.1.1: Serpins [56574] (2 families)

5. Family e.1.1.1: Serpins [56575] (17 proteins)

6. Protein Antitrypsin, alpha-1 [56582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56583] (15 PDB entries)

8. Domain d7api.1: 7api A:,B: [42631]
   complexed with cys

Details for d7api.1

PDB Entry: 7api, 3 Å

PDB Description: the s variant of human alpha1-antitrypsin, structure and implications for function and metabolism

PDB Compounds: (A:) alpha 1-antitrypsin, (B:) alpha 1-antitrypsin

SCOPe Domain Sequences for d7api.1:

Sequence; same for both SEQRES and ATOM records:

>g7api.1 e.1.1.1 (A:,B:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]}
hptfnkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileg
lnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyh
seaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfe
vkdteeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegk
lqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadls
gvteeaplklskavhkavltidekgteaagamfleaipmXsippevkfnkpfvflmieqn
tksplfmgkvvnptqk

Timeline for d7api.1:

• d7api.1 first appeared (with stable ids) in SCOP 1.55
  
• d7api.1 appears in SCOP 1.75
  
• d7api.1 appears in SCOPe 2.02
  
• d7api.1 appears in the current release, SCOPe 2.08