Lineage for d1pmda3 (1pmd A:76-263)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049421Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 1049422Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (1 family) (S)
  5. 1049423Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
    contains an insert subdomain of ClpS-like fold
  6. 1049436Protein Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56521] (1 species)
    the insert subdomain (residues 93-183) is usually disordered in the structures
  7. 1049437Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56522] (6 PDB entries)
  8. 1049447Domain d1pmda3: 1pmd A:76-263 [42562]
    Other proteins in same PDB: d1pmda1, d1pmda2, d1pmda4
    CA-atoms only

Details for d1pmda3

PDB Entry: 1pmd (more details), 3.5 Å

PDB Description: penicillin-binding protein 2x (pbp-2x)
PDB Compounds: (A:) peptidoglycan synthesis multifunctional enzyme

SCOPe Domain Sequences for d1pmda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmda3 d.175.1.1 (A:76-263) Penicillin-binding protein 2x (pbp-2x), N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
rgtiydrngvpiaedatsynvyavidenyksatgkilyvektqfnkvaevfhkyldmees
yvreqlsqpnlkqvsfgakgngityanmmsikkeleaaevkgidfttspnrsypngqfas
sfiglaqlhenedgsksllgtsgmesslnsilagtdgiityekdrlgnivpgteqvsqrt
mdgkdvyt

SCOPe Domain Coordinates for d1pmda3:

Click to download the PDB-style file with coordinates for d1pmda3.
(The format of our PDB-style files is described here.)

Timeline for d1pmda3: