Lineage for d1pmda4 (1pmd A:264-630)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054903Protein Penicillin-binding protein 2x (pbp-2x), transpeptidase domain [56624] (1 species)
  7. 1054904Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56625] (10 PDB entries)
  8. 1054922Domain d1pmda4: 1pmd A:264-630 [42771]
    Other proteins in same PDB: d1pmda1, d1pmda2, d1pmda3
    CA-atoms only

Details for d1pmda4

PDB Entry: 1pmd (more details), 3.5 Å

PDB Description: penicillin-binding protein 2x (pbp-2x)
PDB Compounds: (A:) peptidoglycan synthesis multifunctional enzyme

SCOPe Domain Sequences for d1pmda4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmda4 e.3.1.1 (A:264-630) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
tissplqsfmetqmdafqekvkgkymtatlvsaktgeilattqrptfdadtkegitedfv
wrdilyqsnyepgstmkvmmlaaaidnntfpggevfnsselkiadatirdwdvnegltgg
rmmtfsqgfahssnvgmtlleqkmgdatwldylnrfkfgvptrfgltdeyagqlpadniv
niaqssfgqgisvtqtqmiraftaiandgvmlepkfisaiydpndqtarksqkeivgnpv
skdaasltrtnmvlvgtdpvygtmynhstgkptvtvpgqnvalksgtaqiadeknggylv
gltdyifsavsmspaenpdfilyvtvqqpehysgiqlgefanpilerasamkdslnlqtt
akaleqv

SCOPe Domain Coordinates for d1pmda4:

Click to download the PDB-style file with coordinates for d1pmda4.
(The format of our PDB-style files is described here.)

Timeline for d1pmda4: