| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily) unusual fold |
Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (1 family) ![]() |
| Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins) contains an insert subdomain of ClpS-like fold |
| Protein Penicillin-binding protein 2x (pbp-2x), N-terminal domain [56521] (1 species) the insert subdomain (residues 93-183) is usually disordered in the structures |
| Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [56522] (6 PDB entries) |
| Domain d1pmda3: 1pmd A:76-263 [42562] Other proteins in same PDB: d1pmda1, d1pmda2, d1pmda4 CA-atoms only |
PDB Entry: 1pmd (more details), 3.5 Å
SCOPe Domain Sequences for d1pmda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmda3 d.175.1.1 (A:76-263) Penicillin-binding protein 2x (pbp-2x), N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
rgtiydrngvpiaedatsynvyavidenyksatgkilyvektqfnkvaevfhkyldmees
yvreqlsqpnlkqvsfgakgngityanmmsikkeleaaevkgidfttspnrsypngqfas
sfiglaqlhenedgsksllgtsgmesslnsilagtdgiityekdrlgnivpgteqvsqrt
mdgkdvyt
Timeline for d1pmda3: