Lineage for d1fm5a_ (1fm5 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37323Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 37324Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 37325Family d.169.1.1: C-type lectin domain [56437] (13 proteins)
  6. 37326Protein CD69 [56442] (1 species)
  7. 37327Species Human (Homo sapiens) [TaxId:9606] [56443] (3 PDB entries)
  8. 37331Domain d1fm5a_: 1fm5 A: [42330]

Details for d1fm5a_

PDB Entry: 1fm5 (more details), 2.27 Å

PDB Description: crystal structure of human cd69

SCOP Domain Sequences for d1fm5a_:

Sequence, based on SEQRES records: (download)

>d1fm5a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens)}
sdshvsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryag
reehwvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkp
yk

Sequence, based on observed residues (ATOM records): (download)

>d1fm5a_ d.169.1.1 (A:) CD69 {Human (Homo sapiens)}
sdscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh
wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk

SCOP Domain Coordinates for d1fm5a_:

Click to download the PDB-style file with coordinates for d1fm5a_.
(The format of our PDB-style files is described here.)

Timeline for d1fm5a_: