PDB entry 1fm5

View 1fm5 on RCSB PDB site
Description:
Deposited on 2000-08-16, released 2000-12-18
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-18, with a file datestamp of 2000-12-18.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.243
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1fm5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fm5A (A:)
    sdshvsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryag
    reehwvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkp
    yk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fm5A (A:)
    sdscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh
    wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk