Lineage for d1qo8a3 (1qo8 A:360-505)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37295Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily)
  4. 37296Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family) (S)
  5. 37297Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (3 proteins)
  6. 37298Protein Flavocytochrome c3 (respiratory fumarate reductase) [56432] (2 species)
  7. 37299Species Shewanella frigidimarina [TaxId:56812] [56433] (3 PDB entries)
  8. 37302Domain d1qo8a3: 1qo8 A:360-505 [42316]
    Other proteins in same PDB: d1qo8a1, d1qo8a2, d1qo8d1, d1qo8d2

Details for d1qo8a3

PDB Entry: 1qo8 (more details), 2.15 Å

PDB Description: the structure of the open conformation of a flavocytochrome c3 fumarate reductase

SCOP Domain Sequences for d1qo8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo8a3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina}
hptvgkdsrilisetvrgvgavmvnkdgnrfiselttrdkasdailkqpgqfawiifdnq
lykkakmvrgydhlemlykgdtveqlakstgmkvadlaktvsdyngyvasgkdtafgrad
mplnmtqspyyavkvapgihhtmggv

SCOP Domain Coordinates for d1qo8a3:

Click to download the PDB-style file with coordinates for d1qo8a3.
(The format of our PDB-style files is described here.)

Timeline for d1qo8a3: