SCOP 1.55: Domain d1qo8a1: 1qo8 A:2-102

Lineage for d1qo8a1 (1qo8 A:2-102)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)

5. Family a.138.1.3: Di-heme elbow motif [48711] (5 proteins)

6. Protein Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain [48721] (2 species)

7. Species Shewanella frigidimarina [TaxId:56812] [48722] (3 PDB entries)

8. Domain d1qo8a1: 1qo8 A:2-102 [19696]
   Other proteins in same PDB: d1qo8a2, d1qo8a3, d1qo8d2, d1qo8d3

Details for d1qo8a1

PDB Entry: 1qo8, 2.15 Å

PDB Description: the structure of the open conformation of a flavocytochrome c3 fumarate reductase

SCOP Domain Sequences for d1qo8a1:

Sequence; same for both SEQRES and ATOM records:

>d1qo8a1 a.138.1.3 (A:2-102) Flavocytochrome c3 (respiratory fumarate reductase), N-terminal domain {Shewanella frigidimarina}
tpdmgsfhadmgscqschakpikvtdsethenaqckschgeyaelandklqfdphnshlg
dinctschkgheepkfycnechsfdikpmpfsdakkkkswd

Timeline for d1qo8a1:

• d1qo8a1 appears in SCOP 1.57
  
• d1qo8a1 appears in the current release, SCOPe 2.08