Lineage for d7mo4b1 (7mo4 B:781-817)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037321Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) (S)
    contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain
  5. 3037322Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)
  6. 3037334Protein Nuclear pore complex protein nup153 [161175] (2 species)
  7. 3037338Species Norway rat (Rattus norvegicus) [TaxId:10116] [188480] (8 PDB entries)
  8. 3086487Domain d7mo4b1: 7mo4 B:781-817 [422804]
    Other proteins in same PDB: d7mo4a_, d7mo4b2, d7mo4c_, d7mo4d2
    automated match to d3ch5b_
    complexed with gdp, mg, zn

Details for d7mo4b1

PDB Entry: 7mo4 (more details), 2.4 Å

PDB Description: crystal structure of the znf3 of nucleoporin nup153 in complex with ran-gdp, resolution 2.4 angstrom
PDB Compounds: (B:) Nuclear pore complex protein Nup153

SCOPe Domain Sequences for d7mo4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7mo4b1 g.41.11.1 (B:781-817) Nuclear pore complex protein nup153 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gfgdkfkrpvgswecpvccvsnkaedsrcvsctsekp

SCOPe Domain Coordinates for d7mo4b1:

Click to download the PDB-style file with coordinates for d7mo4b1.
(The format of our PDB-style files is described here.)

Timeline for d7mo4b1:

  • d7mo4b1 is new in SCOPe 2.08-stable