![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) ![]() contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain |
![]() | Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins) |
![]() | Protein Nuclear pore complex protein nup153 [161175] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [188480] (8 PDB entries) |
![]() | Domain d3ch5b_: 3ch5 B: [161628] Other proteins in same PDB: d3ch5a_ automated match to d2gqea1 complexed with gdp, mg, so4, zn |
PDB Entry: 3ch5 (more details), 2.1 Å
SCOPe Domain Sequences for d3ch5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ch5b_ g.41.11.1 (B:) Nuclear pore complex protein nup153 {Norway rat (Rattus norvegicus) [TaxId: 10116]} gfgdkfkpaigtwdcdtclvqnkpeavkcvacetpkp
Timeline for d3ch5b_: