SCOPe 2.08: Domain d7opza2: 7opz A:85-217

Lineage for d7opza2 (7opz A:85-217)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
Protein automated matches [226848] (14 species)
not a true protein
Species Camelus dromedarius [TaxId:9838] [422349] (1 PDB entry)
Domain d7opza2: 7opz A:85-217 [422413]
Other proteins in same PDB: d7opza1, d7opzb1, d7opzc1, d7opzd1
automated match to d6gswa1
complexed with gsh, na

Details for d7opza2

PDB Entry: 7opz (more details), 2.55 Å

PDB Description: camel gstm1-1 in complex with glutathione

PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d7opza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7opza2 a.45.1.1 (A:85-217) automated matches {Camelus dromedarius [TaxId: 9838]}
lcgeteeekirvdvlenqamdtrldfarvcynpdfeklkpgflkeipekmklfseflgkr
twfagdklnyvdflaydvldvyrifepkcldefpnlkdfmsrfeglkkisaymkssrflr
splflkmamwgnk

SCOPe Domain Coordinates for d7opza2:

Click to download the PDB-style file with coordinates for d7opza2.
(The format of our PDB-style files is described here.)

Timeline for d7opza2: