| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Camelus dromedarius [TaxId:9838] [422347] (1 PDB entry) |
| Domain d7opzb1: 7opz B:1-84 [422394] Other proteins in same PDB: d7opza2, d7opzb2, d7opzc2, d7opzd2 automated match to d6gsta2 complexed with gsh, na |
PDB Entry: 7opz (more details), 2.55 Å
SCOPe Domain Sequences for d7opzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7opzb1 c.47.1.0 (B:1-84) automated matches {Camelus dromedarius [TaxId: 9838]}
pmilgywdirglahairllleytgsdyeekiysmgdapdydrsqwlsekfklgldfpnlp
ylidgahrltqsnailryiarkhn
Timeline for d7opzb1: