Lineage for d7opzd1 (7opz D:1-84)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 3086030Species Camelus dromedarius [TaxId:9838] [422347] (1 PDB entry)
  8. 3086042Domain d7opzd1: 7opz D:1-84 [422359]
    Other proteins in same PDB: d7opza2, d7opzb2, d7opzc2, d7opzd2
    automated match to d6gsta2
    complexed with gsh, na

Details for d7opzd1

PDB Entry: 7opz (more details), 2.55 Å

PDB Description: camel gstm1-1 in complex with glutathione
PDB Compounds: (D:) glutathione transferase

SCOPe Domain Sequences for d7opzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7opzd1 c.47.1.0 (D:1-84) automated matches {Camelus dromedarius [TaxId: 9838]}
pmilgywdirglahairllleytgsdyeekiysmgdapdydrsqwlsekfklgldfpnlp
ylidgahrltqsnailryiarkhn

SCOPe Domain Coordinates for d7opzd1:

Click to download the PDB-style file with coordinates for d7opzd1.
(The format of our PDB-style files is described here.)

Timeline for d7opzd1:

  • d7opzd1 is new in SCOPe 2.08-stable