Lineage for d1d6ab_ (1d6a B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37111Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
  4. 37112Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 37113Family d.165.1.1: Plant cytotoxins [56372] (11 proteins)
  6. 37155Protein Pokeweed antiviral protein alpha [56385] (1 species)
  7. 37156Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)
  8. 37158Domain d1d6ab_: 1d6a B: [42198]

Details for d1d6ab_

PDB Entry: 1d6a (more details), 2.1 Å

PDB Description: structure of pokeweed antiviral protein complexed with guanine

SCOP Domain Sequences for d1d6ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ab_ d.165.1.1 (B:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana)}
vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
rvdeikpdvallnyvggscqtt

SCOP Domain Coordinates for d1d6ab_:

Click to download the PDB-style file with coordinates for d1d6ab_.
(The format of our PDB-style files is described here.)

Timeline for d1d6ab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d6aa_