SCOP 1.57: Domain d1d6ab_: 1d6a B:

Lineage for d1d6ab_ (1d6a B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (11 proteins)

6. Protein Pokeweed antiviral protein alpha [56385] (1 species)

7. Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)

8. Domain d1d6ab_: 1d6a B: [42198]

Details for d1d6ab_

PDB Entry: 1d6a, 2.1 Å

PDB Description: structure of pokeweed antiviral protein complexed with guanine

SCOP Domain Sequences for d1d6ab_:

Sequence; same for both SEQRES and ATOM records:

>d1d6ab_ d.165.1.1 (B:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana)}
vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
rvdeikpdvallnyvggscqtt

Timeline for d1d6ab_:

• d1d6ab_ first appeared (with stable ids) in SCOP 1.55
  
• d1d6ab_ appears in SCOP 1.59
  
• d1d6ab_ appears in the current release, SCOPe 2.08