SCOPe 2.01: Domain d1ltht2: 1lth T:150-319

Lineage for d1ltht2 (1lth T:150-319)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Lactate dehydrogenase [56339] (15 species)

7. Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [56346] (2 PDB entries)

8. Domain d1ltht2: 1lth T:150-319 [42147]
   Other proteins in same PDB: d1lthr1, d1ltht1
   complexed with fbp, nad, oxm

Details for d1ltht2

PDB Entry: 1lth, 2.5 Å

PDB Description: t and r states in the crystals of bacterial l-lactate dehydrogenase reveal the mechanism for allosteric control

PDB Compounds: (T:) l-lactate dehydrogenase (t- and r- state tetramer complex)

SCOPe Domain Sequences for d1ltht2:

Sequence; same for both SEQRES and ATOM records:

>d1ltht2 d.162.1.1 (T:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]}
tnldsarlrfliaqqtgvnvknvhayiagehgdsevplwesatiggvpmsdwtplpghdp
ldadkreeihqevknaaykiingkgatnyaigmsgvdiieavlhdtnrilpvssmlkdfh
gisdicmsvptllnrqgvnntintpvsdkelaalkrsaetlketaaqfgf

Timeline for d1ltht2:

• d1ltht2 first appeared (with stable ids) in SCOP 1.55
  
• d1ltht2 appears in SCOP 1.75
  
• d1ltht2 appears in SCOPe 2.02
  
• d1ltht2 appears in the current release, SCOPe 2.08