SCOP 1.55: Domain d1ltht2: 1lth T:150-319

Lineage for d1ltht2 (1lth T:150-319)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily)

4. Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (3 proteins)

6. Protein Lactate dehydrogenase [56339] (8 species)

7. Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [56346] (2 PDB entries)

8. Domain d1ltht2: 1lth T:150-319 [42147]
   Other proteins in same PDB: d1lthr1, d1ltht1

Details for d1ltht2

PDB Entry: 1lth, 2.5 Å

PDB Description: t and r states in the crystals of bacterial l-lactate dehydrogenase reveal the mechanism for allosteric control

SCOP Domain Sequences for d1ltht2:

Sequence; same for both SEQRES and ATOM records:

>d1ltht2 d.162.1.1 (T:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2}
tnldsarlrfliaqqtgvnvknvhayiagehgdsevplwesatiggvpmsdwtplpghdp
ldadkreeihqevknaaykiingkgatnyaigmsgvdiieavlhdtnrilpvssmlkdfh
gisdicmsvptllnrqgvnntintpvsdkelaalkrsaetlketaaqfgf

Timeline for d1ltht2:

• d1ltht2 appears in SCOP 1.57
  
• d1ltht2 appears in the current release, SCOPe 2.08