Lineage for d1ltht2 (1lth T:150-319)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2998778Species Bifidobacterium longum, strain am101-2 [TaxId:216816] [56346] (2 PDB entries)
  8. 2998782Domain d1ltht2: 1lth T:150-319 [42147]
    Other proteins in same PDB: d1lthr1, d1ltht1
    complexed with fbp, nad, oxm

Details for d1ltht2

PDB Entry: 1lth (more details), 2.5 Å

PDB Description: t and r states in the crystals of bacterial l-lactate dehydrogenase reveal the mechanism for allosteric control
PDB Compounds: (T:) l-lactate dehydrogenase (t- and r- state tetramer complex)

SCOPe Domain Sequences for d1ltht2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ltht2 d.162.1.1 (T:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]}
tnldsarlrfliaqqtgvnvknvhayiagehgdsevplwesatiggvpmsdwtplpghdp
ldadkreeihqevknaaykiingkgatnyaigmsgvdiieavlhdtnrilpvssmlkdfh
gisdicmsvptllnrqgvnntintpvsdkelaalkrsaetlketaaqfgf

SCOPe Domain Coordinates for d1ltht2:

Click to download the PDB-style file with coordinates for d1ltht2.
(The format of our PDB-style files is described here.)

Timeline for d1ltht2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ltht1